Protein Info for Shewana3_1412 in Shewanella sp. ANA-3

Annotation: two component, sigma54 specific, Fis family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 PF00072: Response_reg" amino acids 12 to 121 (110 residues), 100.8 bits, see alignment E=1.6e-32 PF14532: Sigma54_activ_2" amino acids 152 to 322 (171 residues), 61.8 bits, see alignment E=2.6e-20 PF00158: Sigma54_activat" amino acids 152 to 317 (166 residues), 223.3 bits, see alignment E=4.8e-70 PF07728: AAA_5" amino acids 174 to 290 (117 residues), 33.7 bits, see alignment E=1.1e-11 PF25601: AAA_lid_14" amino acids 323 to 382 (60 residues), 63.5 bits, see alignment E=4e-21 PF02954: HTH_8" amino acids 407 to 447 (41 residues), 37.9 bits, see alignment 3.4e-13

Best Hits

Swiss-Prot: 50% identical to DCTD_RHIME: C4-dicarboxylate transport transcriptional regulatory protein DctD (dctD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K10126, two-component system, NtrC family, C4-dicarboxylate transport response regulator DctD (inferred from 99% identity to shm:Shewmr7_1424)

Predicted SEED Role

"Two component, Sigma-54 Specific, central transcriptional regulator of acidic amino acid uptake"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KV27 at UniProt or InterPro

Protein Sequence (459 amino acids)

>Shewana3_1412 two component, sigma54 specific, Fis family transcriptional regulator (RefSeq) (Shewanella sp. ANA-3)
MSLPNSIQDYSVLIIDDEPHIGTVLVQLFELEGIKAFATTDPKGIAKLLDRDWAGVVISD
VNMPQLDGISLMQQIRQQDPDLPVVLLTGFGDIAMAVNALKQGAYDFLEKPFNNEHMLDV
VKRALDKRSLTLENRKLKKELESHNVPGPRILGHSVGILRMRHIIDQVIDTPADVLIEGE
TGTGKELVARYLHDHSSRNQANFVAINCGAIPENLIESELFGAEAGAFTGVDKLRIGKFE
YANGGTLFLDEIESTPLSLQVKLLRVLEDRKVERLGSNKSIHLDIRVIAATKVDLKSLCD
TGEFRQDLLYRLNLVTVPIPPLRDRREDIPLLFLHFARMASARYHKALIALNAEQNAILT
SHDWPGNVRELRNLAERYVLLGGEAAFAGSLGNAPSLHTSMSLLQRVEFFERVLIEEALS
HNKGSIKQTMEQLELPRKTLYDKMRKYDLDRKQYINADE