Protein Info for Shewana3_1407 in Shewanella sp. ANA-3

Annotation: Na+/H+ antiporter NhaC (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 522 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 30 to 51 (22 residues), see Phobius details amino acids 73 to 95 (23 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details amino acids 312 to 330 (19 residues), see Phobius details amino acids 350 to 369 (20 residues), see Phobius details amino acids 381 to 401 (21 residues), see Phobius details amino acids 413 to 414 (2 residues), see Phobius details amino acids 416 to 416 (1 residues), see Phobius details amino acids 420 to 442 (23 residues), see Phobius details amino acids 472 to 491 (20 residues), see Phobius details amino acids 497 to 515 (19 residues), see Phobius details PF03553: Na_H_antiporter" amino acids 165 to 491 (327 residues), 260.8 bits, see alignment E=8.5e-82

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1407)

Predicted SEED Role

"Predicted lysine transporter, NhaC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KV22 at UniProt or InterPro

Protein Sequence (522 amino acids)

>Shewana3_1407 Na+/H+ antiporter NhaC (RefSeq) (Shewanella sp. ANA-3)
MTVVSYADSALSLLPPVVAIVLAIFTRRVLLSLGLGIVIGVLLLNQFSPVASGEFLFNSV
KGLFWSEDGVNSWNLYILGFLIVLGMITALITVSGSARAFADWARLHIRNKRDAKLLTMF
LGCVVFIDDYFNSLVVGSVARPVTDRYYISRAKLAYLLDSTAAPVCVISPVSSWGAYIIA
LIGGILTAHGFADSGHLSVFIQMIPMNFYAIFSLLLLLCVAFMGLDIGPMREHELNAQRG
NLYDENKGLPPGANADLPEAETGKILGLFLPITVLVFATLYFMVDSGAQVLTKEGIEFNI
ISAFEKTDVSSSLFFGALIGLAVALVLNLVQGVEKSMVVKGVVQGARSMLPAIYILLFAW
TIAGVIGQLETGKFMASLATGNIPFAFLPALMFVLAGLTAFSTGTSWGTFGIMLPIAADM
AMGSHTAMMLPMLASVLAGAVFGDHCSPISDTTILSSTGASCHHIDHVVTQLPYAVIVAL
ISMVGYVVLGFTESVNAGLLTCGVLFVLSIVWLRFKSQSNAK