Protein Info for Shewana3_1404 in Shewanella sp. ANA-3

Annotation: histone family protein nucleoid-structuring protein H-NS (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 PF22470: Histone_HNS_N" amino acids 1 to 77 (77 residues), 91 bits, see alignment E=3.5e-30 PF00816: Histone_HNS" amino acids 89 to 130 (42 residues), 51.2 bits, see alignment E=8.3e-18

Best Hits

Swiss-Prot: 39% identical to STPA_ECO57: DNA-binding protein StpA (stpA) from Escherichia coli O157:H7

KEGG orthology group: K03746, DNA-binding protein H-NS (inferred from 98% identity to she:Shewmr4_1351)

Predicted SEED Role

"DNA-binding protein H-NS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KV19 at UniProt or InterPro

Protein Sequence (130 amino acids)

>Shewana3_1404 histone family protein nucleoid-structuring protein H-NS (RefSeq) (Shewanella sp. ANA-3)
MSEFLEILTHGRRFKAAVKDLSIEELRDLAAKLDKILVERESMAAEEQQAIAARNAKIEE
IRQQMEAVGLSIDDLGGVAVKAAGKKRAPRPAKYQIEVNGEVIQWTGQGRMPTVFKNEVN
KGRSMDDFLI