Protein Info for Shewana3_1400 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 TIGR00104: tRNA-Thr(GGU) m(6)t(6)A37 methyltransferase TsaA" amino acids 6 to 146 (141 residues), 147 bits, see alignment E=2.1e-47 PF01980: TrmO_N" amino acids 22 to 143 (122 residues), 143 bits, see alignment E=4.9e-46 PF18389: TrmO_C" amino acids 158 to 236 (79 residues), 72.4 bits, see alignment E=2.3e-24

Best Hits

Swiss-Prot: 47% identical to TRMO_HAEIN: tRNA (adenine(37)-N6)-methyltransferase (trmO) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1400)

Predicted SEED Role

"COG1720: Uncharacterized conserved protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KV15 at UniProt or InterPro

Protein Sequence (244 amino acids)

>Shewana3_1400 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MTFTNQITAVATCRTPYKQKFGIPRQPGLVEARGYVELEGHINHLDAVRGIEQYSHLWLL
FCFHENLAQGWKTTVRPPRLGGNEKLGVFATRSTFRPNGIGQSVVKLHRVVQRKGKVCLE
ISGMDLVDGTPIIDIKPYIPFSDSIEGAVGGIAQEAPKLISVVFSELAATQINAYSKQDA
YTDLAELIRGVLGQDPRPAYKKAKDDPKLYQVALYDLDIFWRMAVDEDDREYIQVLELKP
GKCG