Protein Info for Shewana3_1387 in Shewanella sp. ANA-3

Annotation: UDP-glucose/GDP-mannose dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR03026: nucleotide sugar dehydrogenase" amino acids 1 to 378 (378 residues), 340.4 bits, see alignment E=6.5e-106 PF03721: UDPG_MGDP_dh_N" amino acids 1 to 168 (168 residues), 110 bits, see alignment E=1.7e-35 PF00984: UDPG_MGDP_dh" amino acids 192 to 281 (90 residues), 92.8 bits, see alignment E=1.8e-30 PF03720: UDPG_MGDP_dh_C" amino acids 301 to 375 (75 residues), 37.3 bits, see alignment E=4.7e-13

Best Hits

Swiss-Prot: 76% identical to UDG8_ECOLX: UDP-glucose 6-dehydrogenase (ugd) from Escherichia coli

KEGG orthology group: K00012, UDPglucose 6-dehydrogenase [EC: 1.1.1.22] (inferred from 100% identity to shn:Shewana3_1387)

MetaCyc: 76% identical to UDP-glucose 6-dehydrogenase (Escherichia coli K-12 substr. MG1655)
UDP-glucose 6-dehydrogenase. [EC: 1.1.1.22]

Predicted SEED Role

"UDP-glucose 6-dehydrogenase (EC 1.1.1.22)" (EC 1.1.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.22

Use Curated BLAST to search for 1.1.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KV02 at UniProt or InterPro

Protein Sequence (388 amino acids)

>Shewana3_1387 UDP-glucose/GDP-mannose dehydrogenase (RefSeq) (Shewanella sp. ANA-3)
MKIAIAGTGYVGLSNSVLLAQNHKVTAVDVVDYKVELINNRKSPIVDAEIEYFLANYELD
LTATLDRQLAYQDADFVIIATPTDYDPKTNYFNTSSVESVIQDVLMINPNAVMVIKSTVP
VGFTAKVKQKYNCDNILFSPEFLREGKALYDNLHPSRIIVGERSERAEVFANLLVQGAIK
QDIQVLFTDSIEAEAVKLFSNTYLAMRVAYFNELDTYAEAHGLNTRQIIEGVCLDPRIGN
HYNNPSFGYGGYCLPKDTKQLRANYADVPNSIIGAIVESNTTRKDFIADSILSRNPKVVG
IYRLIMKAGSDNFRASSIQGIMKRIKAKGIEVVIYEPVLNESEFFHSRVITDLAEFKAKA
DVIVSNRMANELADVADKLYTRDLFGSD