Protein Info for Shewana3_1379 in Shewanella sp. ANA-3

Annotation: dTDP-glucose 4,6 dehydratase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 1 to 303 (303 residues), 45.5 bits, see alignment E=1.7e-15 TIGR01181: dTDP-glucose 4,6-dehydratase" amino acids 2 to 346 (345 residues), 503.3 bits, see alignment E=1.3e-155 PF01370: Epimerase" amino acids 3 to 262 (260 residues), 237.3 bits, see alignment E=5.1e-74 PF02719: Polysacc_synt_2" amino acids 3 to 114 (112 residues), 54.7 bits, see alignment E=2.9e-18 PF16363: GDP_Man_Dehyd" amino acids 4 to 333 (330 residues), 298.3 bits, see alignment E=2.8e-92 PF01073: 3Beta_HSD" amino acids 4 to 245 (242 residues), 44.4 bits, see alignment E=3.5e-15 PF07993: NAD_binding_4" amino acids 74 to 199 (126 residues), 30.7 bits, see alignment E=5.6e-11

Best Hits

Swiss-Prot: 79% identical to RMLB_SHIFL: dTDP-glucose 4,6-dehydratase (rfbB) from Shigella flexneri

KEGG orthology group: K01710, dTDP-glucose 4,6-dehydratase [EC: 4.2.1.46] (inferred from 100% identity to shn:Shewana3_1379)

MetaCyc: 77% identical to dTDP-glucose 4,6-dehydratase 1 (Escherichia coli K-12 substr. MG1655)
dTDP-glucose 4,6-dehydratase. [EC: 4.2.1.46]

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.46

Use Curated BLAST to search for 4.2.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KUZ4 at UniProt or InterPro

Protein Sequence (359 amino acids)

>Shewana3_1379 dTDP-glucose 4,6 dehydratase (RefSeq) (Shewanella sp. ANA-3)
MKILVTGGAGFIGSAVIRHIIMNTNDSVINVDKLTYAGNLESLKLVSTNPRYNFEQVDIC
DRATLERVFSQYQPDAVMHLAAESHVDRSITGPSDFIQTNIVGTYILLEAARQYWTQLDA
ERKAAFRFHHISTDEVYGDLPHPDEQEGQAVNQYLPLFTETTPYAPSSPYSASKASSDHL
VRAWLRTYGFPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKSLPIYGKGDQIRDWLYVE
DHARALYKVVTEGKVGETYNIGGHNEKQNIEVVKTICSILDSLVPKATPYAEQITFVTDR
PGHDRRYAIDASKMSAELNWQPQETFETGLRKTIEWYLANQEWCQHVQDGTYQRERLGI