Protein Info for Shewana3_1378 in Shewanella sp. ANA-3

Annotation: glycosyl transferase family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 transmembrane" amino acids 224 to 240 (17 residues), see Phobius details PF10111: Glyco_tranf_2_2" amino acids 8 to 113 (106 residues), 47.1 bits, see alignment E=2.4e-16 PF00535: Glycos_transf_2" amino acids 8 to 124 (117 residues), 113.8 bits, see alignment E=8.3e-37

Best Hits

Swiss-Prot: 41% identical to TUAG_BACSU: Putative teichuronic acid biosynthesis glycosyltransferase TuaG (tuaG) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1378)

MetaCyc: 41% identical to UDP-GalNAc:alpha-D-GalNAc-diphosphoundecaprenol alpha-1,6-N-acetylgalactosaminyltransferase (Bacillus subtilis subtilis 168)
2.4.1.-

Predicted SEED Role

"Putative N-acetylgalactosaminyl-diphosphoundecaprenol glucuronosyltransferase" in subsystem Teichuronic acid biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KUZ3 at UniProt or InterPro

Protein Sequence (249 amino acids)

>Shewana3_1378 glycosyl transferase family protein (RefSeq) (Shewanella sp. ANA-3)
MQEQPLVSIIMPSYNSAKTIAESIESVISQTYQNWELLITDDVSVDNTRDIVRSYCAKDS
RIKLFELDVNSGAGASRNNSIENSKGIYIAFLDSDDLWFSDKLSTQIAFMKLNNVLLSYS
AYQKFSREGDGGVIIPPSSVTYEELLTGNVIGCLTAIYNAKVLGKRYMPLIRKRQDMGLW
LNILEDIDMAYGISDVLAKYRVDTGMTKNKLNILKWQWAFYRDVLGLNFFKTIKCFILYA
YKGFLKSRI