Protein Info for Shewana3_1376 in Shewanella sp. ANA-3

Annotation: lipopolysaccharide biosynthesis (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 291 to 314 (24 residues), see Phobius details PF02706: Wzz" amino acids 20 to 123 (104 residues), 72 bits, see alignment E=4.2e-24 PF13807: GNVR" amino acids 274 to 313 (40 residues), 37.2 bits, see alignment 2.3e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1376)

Predicted SEED Role

"Lipopolysaccharide biosynthesis"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KUZ1 at UniProt or InterPro

Protein Sequence (318 amino acids)

>Shewana3_1376 lipopolysaccharide biosynthesis (RefSeq) (Shewanella sp. ANA-3)
MSNELNQYMKDARFPQVQDDEIDLRELFAVIWQGKWLIIAITAVFAIASVAFAILQPNIY
KSEALLAPASEEQGGGLSALASQFGGLASLAGVNLGAKGSTDKTQLAIEVLKSRQFTSEF
IQKHNILANLMAAKKWDRDADKIIYDSELYNEQTNTWVRDVEPPFKPVPSMQEAYKEFSK
IFAANKDKESGMVTISIEHLSPTVAQQWVTWLIQDINKVMKERDVAEAHRSTEFLNKQIA
LTNVADIKTVLYKLIEEQAKTIMFAEVRDEYVFKTIDPALAPEEKAKPKRALICVLGTML
GGMLGLMLVLVRHFMRKE