Protein Info for Shewana3_1375 in Shewanella sp. ANA-3

Annotation: polysaccharide export protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 837 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF02563: Poly_export" amino acids 144 to 211 (68 residues), 53.8 bits, see alignment E=1.7e-18 PF10531: SLBB" amino acids 226 to 275 (50 residues), 21.3 bits, see alignment 2e-08 amino acids 309 to 353 (45 residues), 33.6 bits, see alignment 2.8e-12 amino acids 395 to 419 (25 residues), 15.3 bits, see alignment (E = 1.5e-06) amino acids 507 to 551 (45 residues), 22.7 bits, see alignment 7.1e-09 amino acids 602 to 645 (44 residues), 36.3 bits, see alignment 4e-13 amino acids 733 to 781 (49 residues), 23.3 bits, see alignment 4.7e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1375)

Predicted SEED Role

"Capsular polysaccharide biosynthesis/export periplasmic protein WcbA; Capsular polysaccharide export system protein KpsC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KUZ0 at UniProt or InterPro

Protein Sequence (837 amino acids)

>Shewana3_1375 polysaccharide export protein (RefSeq) (Shewanella sp. ANA-3)
MLQQFKKYIKAVPKTAILVGITATILMGTSAQAITPSPQMIEQFKQLPKSEQERLARQYG
IDPSMITGSSTTATVVENPTVVTPRTETGNNVIDQSEDDKLNQATKTEAKVEAIESKKED
QLKRFGYDLFAGSPSTFAPVSDVPVPAEYMMGPGDTLNVQFFGKENNQFTLTVGRDGAVQ
FPNLGPISLVGLTFAETRELLQQKISQSMIGIESNITMGELRSIRIFVAGDAYKPGSYTV
SSLSTITQALFISGGVNQIGSLRDIQLKRSGKTIGRLDLYDLLLRGDASGDMRLQSGDVV
FVPSTGGTVSVIGEVRRPAIYELKNNETMADVINMASGLNPGAYPKASTIERYSREAVKT
VVSVDLTENSGLSTLAKNGDLLNVRSASSRIDNAITVSGAVIRPGKYQWTNGLTVADLLP
SIWGDLTISADLDYSLLVREINQRGDIEVERINLGRAIGEPKSHYNPTLKPRDSVIVFDY
ADRESLLKPIIKKLKEQSRFGDAAKLVNINGNVRFPGQYPITVNADVKELLIAAGGLEEG
AYTLSAELTRQQVSEQNGVKVEHVQLSLDRVMQNDPAANIKLQSRDILTVRTLPDWQETR
WVTIKGEVKFPGTYSIQRGETLKQVLARAGGMTSDAAPRSAVFLRKSIQQKEQQELAKLA
DELRREIAAKALTKDTPTIGYNDAQMMLNQLENVKTVGRLVVDVNAIELGIESADLMLED
SDALYVPAINQTVSVMGQVQHPSTHRFKTGLTFEQYLALSGGPRKRADESRTYILKADGS
VQMPESSLWFTGGSSMEPGDTIVVPLDTEYKDNLTLWTQVTSIIYNTAVAVSAISGI