Protein Info for Shewana3_1359 in Shewanella sp. ANA-3

Name: fliA
Annotation: flagellar biosynthesis sigma factor (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 PF04542: Sigma70_r2" amino acids 16 to 88 (73 residues), 62.5 bits, see alignment E=5.3e-21 TIGR02479: RNA polymerase sigma factor, FliA/WhiG family" amino acids 16 to 234 (219 residues), 265.2 bits, see alignment E=5.2e-83 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 16 to 233 (218 residues), 98.9 bits, see alignment E=2.4e-32 PF04539: Sigma70_r3" amino acids 97 to 138 (42 residues), 41.2 bits, see alignment 2.9e-14 PF08281: Sigma70_r4_2" amino acids 178 to 229 (52 residues), 30.4 bits, see alignment E=4.9e-11 PF04545: Sigma70_r4" amino acids 182 to 230 (49 residues), 56.2 bits, see alignment 3.8e-19

Best Hits

KEGG orthology group: K02405, RNA polymerase sigma factor for flagellar operon FliA (inferred from 99% identity to she:Shewmr4_1299)

Predicted SEED Role

"RNA polymerase sigma factor for flagellar operon" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KUX4 at UniProt or InterPro

Protein Sequence (237 amino acids)

>Shewana3_1359 flagellar biosynthesis sigma factor (RefSeq) (Shewanella sp. ANA-3)
MNKAAAYTCLDSKTSIVEQYAPLVKRIAHHLLARLPASVQLDDLLQAGMMGLLEASSKFD
GGKGAKFETFAGIRIRGAMLDEIRRGDWVPRSVHRNNRRVAQAIDELEQVLGRDARDTEI
AEKLDMTLDEYHHILNDVSVGKIIGIEDLGVSQDILTSSDNVSDGTYEALAETQFHSALV
EAIKLLPERDALVLSLYYDEALNLKEIGAILEVSESRVSQILSQAMLRLKGKLKHWT