Protein Info for Shewana3_1354 in Shewanella sp. ANA-3

Name: fliR
Annotation: flagellar biosynthesis protein FliR (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 66 to 87 (22 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 124 to 151 (28 residues), see Phobius details amino acids 177 to 201 (25 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details TIGR01400: flagellar biosynthetic protein FliR" amino acids 13 to 254 (242 residues), 243.8 bits, see alignment E=1e-76 PF01311: Bac_export_1" amino acids 13 to 245 (233 residues), 231.5 bits, see alignment E=5.3e-73

Best Hits

Swiss-Prot: 40% identical to FLIR_SALTY: Flagellar biosynthetic protein FliR (fliR) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 100% identity to shn:Shewana3_1354)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KUW9 at UniProt or InterPro

Protein Sequence (265 amino acids)

>Shewana3_1354 flagellar biosynthesis protein FliR (RefSeq) (Shewanella sp. ANA-3)
MELLLDTLMQTIASYMWPLFRVTSMLMVMVVFGATTTPTRVRLLLAVTITLAIAPVLPPV
KDAELFSLSAVFITAQQIIIGVAMGFVTQMVMQTFVLTGQIIGMQTSLGFASMVDPGSGQ
QTPVIGNFFLLLATLIFLAVDGHLLMIRMLVASFETLPISNQGLTLTSYRSLAEWGSYMF
GAALTMSLSAIIALLLVNLSFGVMTRAAPQLNIFSIGFPITMIGGLLILWLTLTPVMAHF
EEVWASAQLLLCDILGLQCQANGIF