Protein Info for Shewana3_1321 in Shewanella sp. ANA-3

Name: flgB
Annotation: flagellar basal body rod protein FlgB (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 TIGR01396: flagellar basal-body rod protein FlgB" amino acids 5 to 132 (128 residues), 116.3 bits, see alignment E=5.4e-38 PF00460: Flg_bb_rod" amino acids 21 to 39 (19 residues), 25.9 bits, see alignment 4e-10

Best Hits

Swiss-Prot: 60% identical to FLGB_AERHH: Flagellar basal body rod protein FlgB (flgB) from Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240)

KEGG orthology group: K02387, flagellar basal-body rod protein FlgB (inferred from 98% identity to shm:Shewmr7_1329)

Predicted SEED Role

"Flagellar basal-body rod protein FlgB" in subsystem Flagellum or Flagellum in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KUT6 at UniProt or InterPro

Protein Sequence (134 amino acids)

>Shewana3_1321 flagellar basal body rod protein FlgB (RefSeq) (Shewanella sp. ANA-3)
MAINFDKALGVHQFTLGIRAERAEVISSNIANADTPHYKARDVDFSAALNIAKTQQQQRN
SLEMTGDEQHFGLAQLTGQYVKFRVPNQPDTGDGNTVDIQQEQSAFMQNALEYQMSLGFL
DSKFSGMKKALRGD