Protein Info for Shewana3_1304 in Shewanella sp. ANA-3

Annotation: N-acetylneuraminate synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 TIGR03586: pseudaminic acid synthase" amino acids 18 to 343 (326 residues), 492.4 bits, see alignment E=3e-152 PF03102: NeuB" amino acids 39 to 277 (239 residues), 288.6 bits, see alignment E=3.7e-90 PF08666: SAF" amino acids 293 to 350 (58 residues), 37.4 bits, see alignment E=3e-13

Best Hits

KEGG orthology group: K01654, N-acetylneuraminate synthase [EC: 2.5.1.56] (inferred from 100% identity to shn:Shewana3_1304)

Predicted SEED Role

"N-acetylneuraminate synthase (EC 2.5.1.56)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 2.5.1.56)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.56

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KUR9 at UniProt or InterPro

Protein Sequence (350 amino acids)

>Shewana3_1304 N-acetylneuraminate synthase (RefSeq) (Shewanella sp. ANA-3)
MTHPMISISGRKIGIDYPPYIVAELSANHNGDIERAKQIIAMAKRCNADAIKLQTYSADT
ITLNSKKEEFMIRGGLWDGKSLYELYQWAQMPWEWHKPLFDYARNLGITIFSSPFDNTAV
DLLEDLNAPVYKVASFEAIDLPLIKYIAGTGKPMIISTGMANRDEIAEAVEAARSGGCNE
LALLHCVSSYPAPSSEYNLKTIADLAKRFNVVGGLSDHTIDNVTAVTSVAVGAAIIEKHV
TLDRNSGGPDDSFSIEEVELERLCTDAKIAWQALGKVDYSQQNSEKATIKYRRSLYIVND
KKAGELILQEDIRSVRPGFGLAPKFYEQIIGRKLTTDVSVNSPVSWSMFE