Protein Info for Shewana3_1302 in Shewanella sp. ANA-3

Annotation: polysaccharide biosynthesis protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03589: UDP-N-acetylglucosamine 4,6-dehydratase (inverting)
  • amino acids 1 to 327 (327 residues), 546.1 bits, E=1.1e-168
• PF00106: adh_short
  • amino acids 5 to 166 (162 residues), 28.5 bits, E=4.6e-10
• PF04321: RmlD_sub_bind
  • amino acids 6 to 148 (143 residues), 35.3 bits, E=3.1e-12
• PF08659: KR
  • amino acids 6 to 84 (79 residues), 22.9 bits, E=3.4e-08
• PF01370: Epimerase
  • amino acids 7 to 192 (186 residues), 74.6 bits, E=3.9e-24
• PF02719: Polysacc_synt_2
  • amino acids 7 to 280 (274 residues), 352.5 bits, E=8.1e-109
• PF16363: GDP_Man_Dehyd
  • amino acids 8 to 127 (120 residues), 42.7 bits, E=2.4e-14
• PF01073: 3Beta_HSD
  • amino acids 8 to 131 (124 residues), 55.5 bits, E=2.1e-18
• PF13460: NAD_binding_10
  • amino acids 11 to 129 (119 residues), 32.6 bits, E=3.2e-11

Best Hits

Swiss-Prot: 68% identical to PSEB_CAMJE: UDP-N-acetylglucosamine 4,6-dehydratase (inverting) (pseB) from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1302)

MetaCyc: 66% identical to UDP-N-acetylglucosamine 4,6-dehydratase subunit (Helicobacter pylori 26695)
UDP-N-acetylglucosamine 4,6-dehydratase (inverting). [EC: 4.2.1.115]

Predicted SEED Role

"UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 4.2.1.-)

MetaCyc Pathways

• CMP-pseudaminate biosynthesis (5/6 steps found)
• UDP-N-acetyl-β-L-fucosamine biosynthesis (1/4 steps found)
• UDP-N-acetyl-β-L-quinovosamine biosynthesis (1/4 steps found)
• CMP-diacetamido-8-epilegionaminic acid biosynthesis (1/7 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (6/24 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Nucleotide sugars metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Porphyrin and chlorophyll metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.- or 4.2.1.115

Sequence Analysis Tools

See A0KUR7 at UniProt or InterPro

Protein Sequence (331 amino acids)

>Shewana3_1302 polysaccharide biosynthesis protein (RefSeq) (Shewanella sp. ANA-3)
MFDNKTILITGGTGSFGQKYTKTILERYKPKRLIIFSRDELKQYEMQQVFNAPCMRYFIG
DVRDGDRLKQAFKDVDFVIHAAALKQVPAAEYNPMECIKTNIHGAENVIRAAISNNVVKV
IALSTDKAASPINLYGATKLASDKLFVAANNVVGDGKTRFAAVRYGNVVGSRGSVVPFFK
QLIANGATSLPITHPDMTRFWITLQEGVDFVLKNFSRMQGGEIFVPKIPSIRITDLAAAY
GPSLEQKIVGIRPGEKMHEVMCPGDDSHHTIEFDDHFVITPSIKFFGRETDFSTNSLGEK
GTLVAAGFEYNSGNNSHFLNVNEILDMDALA