Protein Info for Shewana3_1293 in Shewanella sp. ANA-3

Annotation: methyl-accepting chemotaxis sensory transducer (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 667 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 309 to 335 (27 residues), see Phobius details PF17201: Cache_3-Cache_2" amino acids 38 to 307 (270 residues), 221.3 bits, see alignment E=4.9e-69 PF17203: sCache_3_2" amino acids 101 to 217 (117 residues), 42.2 bits, see alignment E=2.3e-14 PF17202: sCache_3_3" amino acids 107 to 215 (109 residues), 105.3 bits, see alignment E=5.4e-34 PF00672: HAMP" amino acids 336 to 387 (52 residues), 22.4 bits, see alignment 3e-08 PF00015: MCPsignal" amino acids 477 to 633 (157 residues), 144 bits, see alignment E=1.1e-45

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1293)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KUQ8 at UniProt or InterPro

Protein Sequence (667 amino acids)

>Shewana3_1293 methyl-accepting chemotaxis sensory transducer (RefSeq) (Shewanella sp. ANA-3)
MNYKNWPIAKQIGALAFILTLIIFCILSTLSYKSASNVLEDKGISAMKAEMHAVSDMLEL
QYDSLLQLARRNADVFKEMYPGQFSRPDKTVNVLGVSTPALLHEKEQINSSKSKVDRFAN
LTGGTATVFVRDGDDFVRIASSLKKADGSRALGTFLGKTHPGYPTLIKGEVYEGYAKLFG
KDYMTVYRPIKDAQGQVIGILYIGFEITQSLTQLQAAVNKITLEETGSFLLMRKADNVLV
ANPKFNAGEPVTESMLDGLTLSQATQDQSEFRYTNSKNQPMFAYTQTVNGWNWMLIGQVN
ANELNEESLLLLTINAIVAVTGIVLITVLLSFVLIRSLKPLHALQRHMEILGTGDFSHPL
PPSAYDSQNEVDKITTSVSTMSSELRQLISALQASVQSIEQQASKAQRIAKQNGEEAQAL
MQQTDQIATAIEEMSTSIRDVANHAQDGANQSQQVDLAAKEGQQQQTQVVQDLLKLSQQL
SSSHQAVEKVSQESEAISKVTEVINSIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVR
TLAQRTQSSILEISQTIDKLQSQVKTTTSQMAQSHQLGIASANQGEETGKQLEEITRRIG
ELAISSRNIASATEQQSSVAQEITHNLHQISELANEGEHRAAETVNSANDLSSLAVALKQ
QISQFKA