Protein Info for Shewana3_1282 in Shewanella sp. ANA-3

Annotation: type II secretion system protein E (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 TIGR02782: P-type conjugative transfer ATPase TrbB" amino acids 21 to 321 (301 residues), 410 bits, see alignment E=3.2e-127 PF00437: T2SSE" amino acids 114 to 295 (182 residues), 116.7 bits, see alignment E=9.9e-38 PF10412: TrwB_AAD_bind" amino acids 155 to 192 (38 residues), 21.2 bits, see alignment 1.2e-08

Best Hits

Swiss-Prot: 48% identical to TRBB_SINFN: Probable conjugal transfer protein TrbB (trbB) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K03196, type IV secretion system protein VirB11 (inferred from 100% identity to shn:Shewana3_1282)

Predicted SEED Role

"Conjugative transfer protein TrbB" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KUP7 at UniProt or InterPro

Protein Sequence (356 amino acids)

>Shewana3_1282 type II secretion system protein E (RefSeq) (Shewanella sp. ANA-3)
MSAVPQIPPQPRSSAATSLDRRIQMLRTAMGPLIATALEDPDVVEIMLNPDRTLWVDRLS
SGRAPLGVELPEADGERIIRLVAAHVGAEVHRGQPLLTAELPETGERFEGILPPAAPGPA
FALRKRAVNIIGLDQYVADGILTAGQADFLRRAVRERQNVLIAGGTSTGKTTLANALLAE
IAATGDRVLVLEDTIELQCAARDHVPLRTRAGVVSMQELVRATMRLRPDRVVVGEVRGGE
ALDLIKVWGTGHPGGIATIHAGSALGALLRLEQLILEVAVNPPRALIAEAVNVVIHIAGR
GRKRHVETIARVVGFDGTGYRLADALETPFPELIPLPLAADAAALPPSPDQPGELP