Protein Info for Shewana3_1277 in Shewanella sp. ANA-3

Annotation: major facilitator transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 200 to 227 (28 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details amino acids 300 to 320 (21 residues), see Phobius details amino acids 332 to 353 (22 residues), see Phobius details amino acids 365 to 385 (21 residues), see Phobius details PF07690: MFS_1" amino acids 14 to 322 (309 residues), 115.2 bits, see alignment E=1.6e-37 amino acids 213 to 395 (183 residues), 42.7 bits, see alignment E=1.8e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1277)

Predicted SEED Role

"Major facilitator family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KUP2 at UniProt or InterPro

Protein Sequence (407 amino acids)

>Shewana3_1277 major facilitator transporter (RefSeq) (Shewanella sp. ANA-3)
MKQTHRTHPGVWALAVTAFAIGVAEFIVVGILPAIADDLNVPLARAGGLVGLYALALAVG
TPIVVLTLARLPRKPLLMALVAVFLAGNLISALSASYELLLAGRILTAVAHGSFFAIGAT
VAARLAPKGQASRAIAMMFAGLTLAMVVGVPLGSLIGNALGWRLPFFAVAGLAGLAFLAT
ARWVPALPTQATGPVGTQLAALASAPILAMMAITVLGFGASFATFTFINPILTDITGFST
HTVSLLLVVFGVATLVGNLAGGRWAASLGWPVALRRMLAGLLLVLVALAVALPLKWVMVP
LLFVWGVLAFGMSPGFQAGMLETAGRWTPRAVDFASALNISAFNLGITLGETLGSGLVAQ
EQMDMTPWAGVALVLLAQLPLLWLVRKNNQPIATKLPLSQEGRNVSS