Protein Info for Shewana3_1243 in Shewanella sp. ANA-3

Annotation: cyd operon protein YbgT (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08173: YbgT_YccB
  • amino acids 1 to 26 (26 residues), 62.3 bits, E=1.7e-21
• TIGR02106: cyd operon protein YbgT
  • amino acids 1 to 30 (30 residues), 67.9 bits, E=3.5e-23

Best Hits

Swiss-Prot: 64% identical to CYDX_ECOLI: Cytochrome bd-I ubiquinol oxidase subunit X (cydX) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to saz:Sama_2347)

MetaCyc: 64% identical to cytochrome bd-I accessory subunit CydX (Escherichia coli K-12 substr. MG1655)
RXN0-5266 [EC: 7.1.1.7]; 1.11.1.- [EC: 7.1.1.7]; 1.11.1.- [EC: 7.1.1.7]

Predicted SEED Role

No annotation

MetaCyc Pathways

• NADH to cytochrome bd oxidase electron transfer I (2/2 steps found)
• NADH to cytochrome bd oxidase electron transfer II (2/2 steps found)
• succinate to cytochrome bd oxidase electron transfer (2/2 steps found)
• pyruvate to cytochrome bd oxidase electron transfer (1/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.1.1.7

Sequence Analysis Tools

See A0KUK9 at UniProt or InterPro

Protein Sequence (38 amino acids)

>Shewana3_1243 cyd operon protein YbgT (RefSeq) (Shewanella sp. ANA-3)
MWYFTWILGVLLACSFGVINALWLENTENMDRSSDDAE