Protein Info for Shewana3_1239 in Shewanella sp. ANA-3

Annotation: lytic transglycosylase, catalytic (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00497: SBP_bac_3" amino acids 35 to 256 (222 residues), 75.6 bits, see alignment E=3.2e-25 PF01464: SLT" amino acids 289 to 388 (100 residues), 69.1 bits, see alignment E=2.5e-23

Best Hits

Swiss-Prot: 100% identical to MLTF_SHESA: Membrane-bound lytic murein transglycosylase F (mltF) from Shewanella sp. (strain ANA-3)

KEGG orthology group: None (inferred from 100% identity to shm:Shewmr7_1308)

Predicted SEED Role

"Transglycosylase, Slt family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KUK5 at UniProt or InterPro

Protein Sequence (478 amino acids)

>Shewana3_1239 lytic transglycosylase, catalytic (RefSeq) (Shewanella sp. ANA-3)
MTRFLFAIILGFLLTACQQVTVEETEYVPHKLTELRVGTLYGPQIYMTSGQGNSGFDYDM
AVLFAEYLDVPLKMVPYTNRAELYDALKKNEIDIIAAGMTETPARREQFRLGPPLYRVNQ
VLVYREGMPTPKDITDLKGKITVIADSSFVETLTQLQKRHPTLVWDQVTDKDSEELLAMI
ANKEIDYTIADSSSVQINRRYLPDLRSGLVLEEKLDVVWLLPPTHSDGLMSQLLAFWHQE
KLAGTLDHLNEKYFGHVKRFDYIDTRAFLRAIETVLPRYRQLFETHAGDLDWRKLAATSY
QESHWNPNARSPTGVRGMMMLTQPTAKEIGITNRLDAEESIRGGAAYLRDMINRLPESIP
ESQRMWFALASYNIGYAHVEDARKLAESMELNPNAWRDLKKVLPLLQKRKYYQKTRYGYA
RGSEAVHYVDSIRRYYDTLVWVDNQSKQQNSDEEEPSDLASEDGPAPVPGTLSPDKPK