Protein Info for Shewana3_1215 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF09140: MipZ" amino acids 2 to 55 (54 residues), 26.2 bits, see alignment E=7.2e-10 amino acids 73 to 141 (69 residues), 20.9 bits, see alignment E=2.9e-08 PF13614: AAA_31" amino acids 3 to 54 (52 residues), 28.1 bits, see alignment E=2.7e-10 PF01656: CbiA" amino acids 4 to 184 (181 residues), 38.5 bits, see alignment E=1.6e-13

Best Hits

KEGG orthology group: K03496, chromosome partitioning protein (inferred from 100% identity to shn:Shewana3_1215)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParA" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KUI1 at UniProt or InterPro

Protein Sequence (260 amino acids)

>Shewana3_1215 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MIVLVGGEKGGSGKSCLAQNIAVFLTTECGASVIMVDCDPQRTTSDWIQARNNNPKLASI
NCVQLYGKIRNDLLSLEQHYDFVLVDCGGQDNLALRATMSVASHILMPLRPKRRDLKTVS
HMDDIVATCKMINPKLHASFVITQCPNLPNQANRILEAKEVCKTYDINVLDAITYSRNIY
DDSEESGLSVIEIEPKGKAATEIRAIACEMFQVDCAASLTALLRPSTPMAAHRAAMNQPQ
PNHLRGQYGTQRPQEKRYAI