Protein Info for Shewana3_1193 in Shewanella sp. ANA-3

Annotation: pyrroline-5-carboxylate reductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03446: NAD_binding_2
  • amino acids 5 to 85 (81 residues), 22.7 bits, E=2.2e-08
• PF03807: F420_oxidored
  • amino acids 5 to 99 (95 residues), 74 bits, E=3.1e-24
• TIGR00112: pyrroline-5-carboxylate reductase
  • amino acids 6 to 268 (263 residues), 246.9 bits, E=1.4e-77
• PF01210: NAD_Gly3P_dh_N
  • amino acids 33 to 109 (77 residues), 24.1 bits, E=7.8e-09
• PF02153: PDH_N
  • amino acids 39 to 125 (87 residues), 27 bits, E=7.3e-10
• PF14748: P5CR_dimer
  • amino acids 163 to 268 (106 residues), 113.6 bits, E=1.3e-36

Best Hits

Swiss-Prot: 55% identical to P5CR_VIBAL: Pyrroline-5-carboxylate reductase (proC) from Vibrio alginolyticus

KEGG orthology group: K00286, pyrroline-5-carboxylate reductase [EC: 1.5.1.2] (inferred from 100% identity to shn:Shewana3_1193)

MetaCyc: 33% identical to ProC (Acetoanaerobium sticklandii)
Pyrroline-5-carboxylate reductase. [EC: 1.5.1.2]

Predicted SEED Role

"Pyrroline-5-carboxylate reductase (EC 1.5.1.2)" in subsystem Proline Synthesis (EC 1.5.1.2)

MetaCyc Pathways

• L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
• L-proline biosynthesis III (from L-ornithine) (3/3 steps found)
• L-arginine degradation XIII (reductive Stickland reaction) (4/5 steps found)
• L-arginine degradation VI (arginase 2 pathway) (3/4 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.2

Sequence Analysis Tools

See A0KUF9 at UniProt or InterPro

Protein Sequence (272 amino acids)

>Shewana3_1193 pyrroline-5-carboxylate reductase (RefSeq) (Shewanella sp. ANA-3)
MSQQKICFIGAGNMTRSIISGLIRSGYPAALVQATNPSQGKLDALAADFGVRVSQDNFSA
AQDADVIVLSVKPQLMEQVCQALQGIDMSNKLVITIAAGIKAERYSQYLAQSITLVRTMP
NTPMQIGVGMTGLYAPQPLSDAQQAIAERLMSSGGEIVWVNEESEINQVIALAGSSPAYF
FLLMESMIDAGKQMGMDEAKARSLVQQAALGAAMMAKQNPELTLGNLRENVTSKGGTTAQ
AIATFEAADLRGVVKNAMENCIKRAEEMANTF