Protein Info for Shewana3_1171 in Shewanella sp. ANA-3

Annotation: cyclopropane-fatty-acyl-phospholipid synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 PF02353: CMAS" amino acids 133 to 399 (267 residues), 283.8 bits, see alignment E=3.5e-88 PF13489: Methyltransf_23" amino acids 181 to 299 (119 residues), 33.6 bits, see alignment E=7.9e-12 PF08242: Methyltransf_12" amino acids 195 to 289 (95 residues), 32.9 bits, see alignment E=2.2e-11 PF08241: Methyltransf_11" amino acids 195 to 291 (97 residues), 35.8 bits, see alignment E=2.6e-12 PF13649: Methyltransf_25" amino acids 195 to 288 (94 residues), 44.6 bits, see alignment E=4.9e-15

Best Hits

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 100% identity to she:Shewmr4_1170)

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KUD7 at UniProt or InterPro

Protein Sequence (418 amino acids)

>Shewana3_1171 cyclopropane-fatty-acyl-phospholipid synthase (RefSeq) (Shewanella sp. ANA-3)
MENTASQSSVITAKLPDSLARKLLLKALENLPHGCLTLVEGDKSYRFGEHHSDLHATLVV
KHPSFYRQAMFSGSIGAGESYIQGHWTSPDLTKVVQLFARNLPLLDKIEAKFGWLTGSVN
RMKHLLNRNSQQGSKRNILAHYDLGNALYEQFLDREMLYSSALYPDSEASLEQAQLHKLK
TICERLDLQPGQTLLEIGTGWGALAIYAAKHYGVHVTTTTISDAQYAYAKARVEREGLSD
SITLLTEDYRNLGGTYDRLVSIEMIEAVGHEYLPGFFKKLESLLKPHGRMLLQAITIADQ
RYDSYRKGVDFIQRYIFPGGCLPSVHQMVGHLAKRTDMQVWSIDDMGLDYAKTLRDWHNN
FDRAIEQVQALGYGDDFIRMWKFYLSYCEGGFLERTTSTVHLVAVRPDYRLPNAVSGN