Protein Info for Shewana3_1125 in Shewanella sp. ANA-3

Annotation: DNA mismatch repair protein MutS (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 861 TIGR01070: DNA mismatch repair protein MutS" amino acids 12 to 858 (847 residues), 1255.7 bits, see alignment E=0 PF01624: MutS_I" amino acids 13 to 124 (112 residues), 143.6 bits, see alignment E=8.4e-46 PF05188: MutS_II" amino acids 133 to 257 (125 residues), 116.6 bits, see alignment E=3.3e-37 PF05192: MutS_III" amino acids 274 to 563 (290 residues), 179.9 bits, see alignment E=2.2e-56 PF05190: MutS_IV" amino acids 432 to 521 (90 residues), 103.3 bits, see alignment E=2.1e-33 PF00488: MutS_V" amino acids 614 to 801 (188 residues), 295.1 bits, see alignment E=7.8e-92 PF27441: MutS_C" amino acids 831 to 860 (30 residues), 48 bits, see alignment (E = 2.4e-16)

Best Hits

Swiss-Prot: 67% identical to MUTS_ECO24: DNA mismatch repair protein MutS (mutS) from Escherichia coli O139:H28 (strain E24377A / ETEC)

KEGG orthology group: K03555, DNA mismatch repair protein MutS (inferred from 68% identity to eca:ECA1053)

MetaCyc: 67% identical to DNA mismatch repair protein MutS (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA mismatch repair protein MutS" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KU91 at UniProt or InterPro

Protein Sequence (861 amino acids)

>Shewana3_1125 DNA mismatch repair protein MutS (RefSeq) (Shewanella sp. ANA-3)
MNPIDTDDLEKHTPMMRQYLTMKAEHHDMLLFYRMGDFYELFYDDAKRASELLGISLTAR
GKSGGDPIPMAGIPYHAVEGYLAKLVQIGQSVAICEQIGDPATSKGPVERKVVRIVTPGT
LTDEALLQERQDNLLAAVYQGKVGFGYATLDVSSGRFVIAELETKESLEAELQRTNPVEI
LYSEDFGAMELLHHFKGKRRRPEWEFDYDTSIKLLLAQFGTKDLHGFGITDARLSLQAAG
CLMQYVKDTQRTALPHINAITRFNQTDTIVLDAATRRNLELTQNLSGGRDNTLAAVLDNT
ATAMGSRMLQRWIHQPLRDHAQIFARQTAVNELLETTAHESLHDQLKALGDIERIMARLA
LRTARPRDFARLRQALNLLPQLQQSLAQLSAPHTVKLGQLLGEFPEEQQLLERAIVDNPP
MLIRDGGVIREGYNAELDEWRGLSEGATDYLVQLEAREKERTGIATLKVGYNRVHGYYIE
VSRLQSQQVPLNYQRRQTLKNMERYITPELKEYEEKVLSSQGKALALEKQLWDELFDLIL
PKLHELQAFARAAAELDVLSNFAERAETLGYTCPELSSEIGVKIEAGRHPVVERVSQTPF
IANPVTLHNQRRMLIVTGPNMGGKSTYMRQVALITLMAHIGCFVPADRAIIGPIDRIFTR
IGASDDLASGRSTFMVEMTETANILHNATAQSLVLMDEIGRGTSTYDGLSLAWSAAEYLA
QQVGAMTLFATHYFELTQLPELMAGVYNVHLDAIEHEDTIAFMHAVQEGAASKSYGLQVA
ALAGVPARVIKAAKHKLHQLESRDHQVEGANVNGTRAPIQTLLALPEPVENPAVSKLKDI
NPDNLTPKQALDLLYELKRLS