Protein Info for Shewana3_1114 in Shewanella sp. ANA-3

Name: mazG
Annotation: nucleoside triphosphate pyrophosphohydrolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 TIGR00444: MazG family protein" amino acids 28 to 287 (260 residues), 321.3 bits, see alignment E=2.3e-100 PF03819: MazG" amino acids 45 to 118 (74 residues), 95.9 bits, see alignment E=1.3e-31 amino acids 195 to 258 (64 residues), 35.8 bits, see alignment E=8.2e-13

Best Hits

KEGG orthology group: K02428, nucleoside-triphosphate pyrophosphatase [EC: 3.6.1.19] (inferred from 100% identity to shn:Shewana3_1114)

Predicted SEED Role

"Nucleoside triphosphate pyrophosphohydrolase MazG (EC 3.6.1.8)" (EC 3.6.1.8)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.19 or 3.6.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KU80 at UniProt or InterPro

Protein Sequence (292 amino acids)

>Shewana3_1114 nucleoside triphosphate pyrophosphohydrolase (RefSeq) (Shewanella sp. ANA-3)
MTSHITPSITELPATALSATDVAPLLKIMEKLRDPQTGCPWDKAQTYQTIVPFTLEEAYE
VADTIERLALDELPDELGDLLFQVVFYCQLGKEQGRFDFSTVVNKITDKLTRRHPHVFGN
EVFEADASSQQMKANWEAIKASEREQKALAAGGASLSEVSVLDDIPRAQPALSRSIKIQQ
RVARVGFDWPELEPVVAKIHEEIDEVFAEVNQPTLDQAKVQAEMGDLLFAVVNLARHLKV
DPEQALRQANVKFERRFKGVEAFARQNNKALEEHSLEELDVYWDKVKQGESR