Protein Info for Shewana3_1105 in Shewanella sp. ANA-3

Annotation: transporter, putative (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 62 to 86 (25 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 158 to 186 (29 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details amino acids 230 to 253 (24 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 295 to 312 (18 residues), see Phobius details PF03547: Mem_trans" amino acids 3 to 311 (309 residues), 113.2 bits, see alignment E=5.5e-37

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 100% identity to shn:Shewana3_1105)

Predicted SEED Role

"TRANSPORTER"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KU71 at UniProt or InterPro

Protein Sequence (320 amino acids)

>Shewana3_1105 transporter, putative (RefSeq) (Shewanella sp. ANA-3)
MNILTPLFAVFGIMLLGTLVQKLRFLPVETDQVLNQYVYYIAFPAILLIALAQQPIEEIL
QWGFIAGYSAAMLVIYLVCIGISLLANPKQHAIAAVRALNATFGNTAFIGIPLLIILFPQ
QQSALVAAAIASLLSVLMFAVALVSLELATNKQRQHHAAVIMLLAVVKNPIVIGCFIGVA
ISALGITLPSGLAMMIQQIGNTSSPCALFAVGMVLAKAMRYQKDSKVFSLTNFIELSLIN
LFKLILQPALVYFMLKGVGVTGDYLVMGVILSALPTAASVYLLAQRYNTQASSSAQGILF
GTIVTFFSLPILEQLVKTYS