Protein Info for Shewana3_1082 in Shewanella sp. ANA-3

Annotation: major facilitator transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 46 to 63 (18 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 207 to 227 (21 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 302 to 321 (20 residues), see Phobius details amino acids 330 to 352 (23 residues), see Phobius details amino acids 360 to 381 (22 residues), see Phobius details PF07690: MFS_1" amino acids 14 to 350 (337 residues), 148.6 bits, see alignment E=2.2e-47 PF00083: Sugar_tr" amino acids 39 to 183 (145 residues), 27.4 bits, see alignment E=1.6e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1082)

Predicted SEED Role

"Multidrug resistance protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KU48 at UniProt or InterPro

Protein Sequence (392 amino acids)

>Shewana3_1082 major facilitator transporter (RefSeq) (Shewanella sp. ANA-3)
MKIKPPLWLCVLLMMFPQIMETIYSPALPNIAENFAVSVTSASQTLSVYFIAFAVGVFCW
GRLADIIGRRNAMLAGLLCYAIGSACALMISDFTLLLFARVLSAFGAAVGSVITQTMMRD
SYNGEELAKVFSVMGMSLGISPIIGLLLGSILSAYWGYQGVFVALMVSAIVLLFLSVKSL
PETKPEHTQKIAIVELAIKMLTDIGIIKNTLLVASFNLMWFSYFSLAPFMFEARGLSTLA
FGASGLLLGFGAFLGSYFNKLLLGRGYSCALLVRLASLMALFGGLGIWLFQSTNIGLNNV
YFLLPMLLIVIAYGIAIPNILSSALANYRAYAGSAGALFGLFYYILLGLGLGGAGMVSHL
GGVITLAALLCVGLGYAGLAGRTVLRGKSSRA