Protein Info for Shewana3_1049 in Shewanella sp. ANA-3

Annotation: DNA repair protein RadA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 TIGR00416: DNA repair protein RadA" amino acids 1 to 451 (451 residues), 708.4 bits, see alignment E=1.9e-217 PF18073: Zn_ribbon_LapB" amino acids 8 to 35 (28 residues), 37.2 bits, see alignment (E = 5.5e-13) PF06745: ATPase" amino acids 80 to 150 (71 residues), 38.7 bits, see alignment E=2.3e-13 PF13481: AAA_25" amino acids 83 to 222 (140 residues), 56.8 bits, see alignment E=7.4e-19 PF13541: ChlI" amino acids 345 to 430 (86 residues), 33.4 bits, see alignment E=1.2e-11 PF05362: Lon_C" amino acids 352 to 446 (95 residues), 29.5 bits, see alignment E=1.6e-10

Best Hits

Swiss-Prot: 78% identical to RADA_SALTY: DNA repair protein RadA (radA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K04485, DNA repair protein RadA/Sms (inferred from 100% identity to she:Shewmr4_1045)

Predicted SEED Role

"DNA repair protein RadA" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KU15 at UniProt or InterPro

Protein Sequence (454 amino acids)

>Shewana3_1049 DNA repair protein RadA (RefSeq) (Shewanella sp. ANA-3)
MAKNKTAYVCNECGQDFPRWQGQCSACQEWNTITEVRLGAASPGRGTKFAGYAGAGSSEV
KTLDQIDLNALPRIVSHFGELDRVLGGGIVPGSAILIGGHPGAGKSTLLLQTLCHLAEQM
PALYVTGEESLQQVAMRAHRLGLPTNKLRMLSETSVEQICEVALQESPKVIVVDSIQVMH
MSDVASSPGSVSQVRESASYLTRFAKQNGIAVIMVGHVTKDGSLAGPKVLEHCIDCSVMF
EGDSDSRYRTLRSHKNRFGAINELGVFAMTERGLKEVANPSAIFLSRGEEESSGSLVMVV
WEGTRPLLVELQVLVDNSAMSNPRRVAVGMDANRLAMLLAVMHRHGGLQMSDQDVFVNVV
GGVKVTETSADLTLLLAMVSSFRGDILPSDLVVFGEVGLSGEIRPVPNGQERLVEAAKHG
FKRAIVPRANVPKKPPAGMEVVGVAKLSEALEAI