Protein Info for Shewana3_1000 in Shewanella sp. ANA-3

Annotation: rare lipoprotein B (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04390: LptE
  • amino acids 35 to 157 (123 residues), 68.8 bits, E=3.6e-23

Best Hits

Swiss-Prot: 41% identical to LPTE_PECAS: LPS-assembly lipoprotein LptE (lptE) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K03643, LPS-assembly lipoprotein (inferred from 99% identity to son:SO_1173)

MetaCyc: 34% identical to LPS assembly lipoprotein (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-51 [EC: 7.5.2.5]

Predicted SEED Role

"LPS-assembly lipoprotein RlpB precursor (Rare lipoprotein B)" in subsystem KDO2-Lipid A biosynthesis

MetaCyc Pathways

• Salmonella typhimurium LT2 lipopolysaccharide biosynthesis (final steps) (1/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.5

Sequence Analysis Tools

See A0KTW6 at UniProt or InterPro

Protein Sequence (164 amino acids)

>Shewana3_1000 rare lipoprotein B (RefSeq) (Shewanella sp. ANA-3)
MLIKRLAFAIMALVIMTSAGCGFKLQRSYQIPEQLNQLSLSSSDEYSELTRLVRERLRLN
NVKIVDAANDVPVLRLITDSLERSTLSLYPTGNVAEYELIYFVEFAVALPGKEAQPFKIE
IRRDYLDDPRTALAKSREMELLVKEMRIQAADRILQSMASTEVN