Protein Info for Shewana3_0987 in Shewanella sp. ANA-3

Annotation: SSU ribosomal protein S18P alanine acetyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 TIGR01575: ribosomal-protein-alanine acetyltransferase" amino acids 10 to 142 (133 residues), 114.4 bits, see alignment E=2.1e-37 PF00583: Acetyltransf_1" amino acids 36 to 120 (85 residues), 60.4 bits, see alignment E=5.2e-20 PF13302: Acetyltransf_3" amino acids 41 to 121 (81 residues), 30.9 bits, see alignment E=1.1e-10 PF08445: FR47" amino acids 42 to 122 (81 residues), 28.7 bits, see alignment E=2.7e-10 PF13673: Acetyltransf_10" amino acids 44 to 126 (83 residues), 42.5 bits, see alignment E=1.6e-14 PF13508: Acetyltransf_7" amino acids 46 to 122 (77 residues), 46.9 bits, see alignment E=7.5e-16

Best Hits

KEGG orthology group: K03789, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 100% identity to shn:Shewana3_0987)

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.128

Use Curated BLAST to search for 2.3.1.- or 2.3.1.128

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTV3 at UniProt or InterPro

Protein Sequence (150 amino acids)

>Shewana3_0987 SSU ribosomal protein S18P alanine acetyltransferase (RefSeq) (Shewanella sp. ANA-3)
MQIVLLTPTDVSQIARIEASAHSHPMSENNLADCFGHLYRVLGLMQRDGELLGFAIVQQI
VDEATLLDICLSPAQQGRGYGHLLLTAVIDCAKAAKAVVLMLEVRESNLAARALYQKRGF
VETGRRKGYYPLAEGKEDAILMDLALSETA