Protein Info for Shewana3_0983 in Shewanella sp. ANA-3

Annotation: TonB-dependent siderophore receptor (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 723 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF07715: Plug" amino acids 70 to 172 (103 residues), 68.9 bits, see alignment E=5.1e-23 TIGR01783: TonB-dependent siderophore receptor" amino acids 71 to 723 (653 residues), 351.4 bits, see alignment E=5.9e-109 PF00593: TonB_dep_Rec_b-barrel" amino acids 243 to 692 (450 residues), 220.9 bits, see alignment E=6.2e-69

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to shn:Shewana3_0983)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTU9 at UniProt or InterPro

Protein Sequence (723 amino acids)

>Shewana3_0983 TonB-dependent siderophore receptor (RefSeq) (Shewanella sp. ANA-3)
MLFIFGVKMAVYISHKRSAFVLGVALLALDASVPLLAAEAMPTDTVGLNGDIERLSIHYR
QAYRGNVPATELPQAITVLDEQLIKDTGLTRFQDLLDYSASVARQNNGGGLWDSFSLRGF
PGNENMPSGYLINGFNGGRGFSGHRDLSNVAYVEILKGPGSALYGRSEPGGTVNIVTKKP
QYEAQGYLKASAGSFDQYRLEGDFTSGLTDSLAFRINGAWQEHDSFRDYVFSDKKIVTPS
LRWQLSDRSSLLYEVEYLKQEQLFDRGVVVLNNDFNTVSRSRYLGEPNDGPTKVDATGHQ
LTYEYELNEDWSLTAGYNYRDSSLNGYSSDAELAKGRQSLYDDGRTLTRQHRYRDYASED
HSVRAELSGQFDTGSIRHNLLLGTDAYHYRLKTGLYRYRGQKGAYAIDIFTPQYGAAQPE
VSLLYENRETQDAWGAYLQDQLELTERWKLHLGLRFDRYSQEIAEQVNASLSDQSDHRVS
PKVGLVYQWSEALSVYGSYSEGFLPLSGTDYAGNPFEPEESKSVELGVKFNSTWFELPVN
GSLAWFDAQKSNILTSDPVNVGFSATLGEAKSTGIELDITAELTENLQASLSYAYLNTRT
ANDSLNLDWGVLIPAGSPLVNVPKHTGSVILKQDLNDLSIDGHLGLSWRYVDSRLGDSAD
PSFQLPSYQLLGMFFTTRLGENLSLALNVDNLLDEHYIASSYSALWAVPGEPRNVKVSVS
YEF