Protein Info for Shewana3_0960 in Shewanella sp. ANA-3

Annotation: chaperone protein DnaJ (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 PF00226: DnaJ" amino acids 5 to 67 (63 residues), 94.6 bits, see alignment E=6.2e-31 TIGR02349: chaperone protein DnaJ" amino acids 5 to 348 (344 residues), 462.6 bits, see alignment E=5.2e-143 PF01556: DnaJ_C" amino acids 119 to 332 (214 residues), 177.2 bits, see alignment E=4.7e-56 PF00684: DnaJ_CXXCXGXG" amino acids 146 to 206 (61 residues), 62.1 bits, see alignment E=9.9e-21 PF27439: DnaJ_C_2" amino acids 338 to 374 (37 residues), 41.5 bits, see alignment 2.2e-14

Best Hits

Swiss-Prot: 100% identical to DNAJ_SHESA: Chaperone protein DnaJ (dnaJ) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K03686, molecular chaperone DnaJ (inferred from 100% identity to shn:Shewana3_0960)

MetaCyc: 73% identical to chaperone protein DnaJ (Escherichia coli K-12 substr. MG1655)
1.8.4.-

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTS6 at UniProt or InterPro

Protein Sequence (377 amino acids)

>Shewana3_0960 chaperone protein DnaJ (RefSeq) (Shewanella sp. ANA-3)
MSKRDYYEVLGVGRDASEREIKKAYKRLAMKFHPDRNPGDKAAEASFKEVKEAYEILTDA
NKKAAYDQFGHAGVDPNRGGGGGYGGAGDFGDIFGDVFGDIFGGGRRGGQRQAARGSDLR
YNLELSLEEAVKGLTKELRIPTLASCDVCDGSGAKKGSSATTCGTCHGQGQVQMRQGFFT
VQQPCPTCHGRGKIIKDPCSKCHGDGRVEKTKTLSVKIPAGVDTGDRIRLAGEGEAGEFG
APPGDLYVQVTVREHAIFVRDGNNLYCEVPISFSKAALGGEIEVPTLDGKVSLKIPAETQ
TGRMFRLRGKGVKSVRSHAVGDLLCKVVMETPVNLNERQKELLREFEATLTGESKKHSPK
AEGFFDGVKKFFQDLNS