Protein Info for Shewana3_0948 in Shewanella sp. ANA-3

Annotation: methyl-accepting chemotaxis sensory transducer (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 667 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 312 to 336 (25 residues), see Phobius details PF02743: dCache_1" amino acids 37 to 264 (228 residues), 65.5 bits, see alignment E=1.1e-21 PF22673: MCP-like_PDC_1" amino acids 125 to 201 (77 residues), 30.7 bits, see alignment E=7.7e-11 PF00672: HAMP" amino acids 340 to 387 (48 residues), 39.4 bits, see alignment 1.2e-13 PF00015: MCPsignal" amino acids 450 to 631 (182 residues), 141.2 bits, see alignment E=6.3e-45

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0948)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTR4 at UniProt or InterPro

Protein Sequence (667 amino acids)

>Shewana3_0948 methyl-accepting chemotaxis sensory transducer (RefSeq) (Shewanella sp. ANA-3)
MRYIKRSLSLQLVVTIVGALAVLLTLVAALLVNKESNNTRKQVDADISALVALKANEIGG
YFVAKGQVIHSVFAEPGLINWFSQYHARGSNLANDQQYQDIIRYFRSFSDRDTDVKSVFF
GSANTFEYFDLNGRFDGDPNYYTNKRPWWQEAIDQRGLFVGDPAVDANDGSISATVKTPV
YGANGELIGIGGMDILIDTIGKTLLAPIKYRNYGQAFLMTDEGKLVYFPGFSDKFPPGSL
ANQIDSQFKDTSGFTALRQQMQREAQGFAEVTFNGVPQRVTFVSVGGDYPKQKWHLAFML
PHEVIEAPVTEAFWNACFVALGIMLLVGITVWLMLLPFRRQLSKLLDAMEDIAEGDSDLS
QRILMEREDELGKLGDAFNRFAEKVQQMLLHTRNLTQEVGTGVMDARQVCDLAVSSVSSQ
KQQIDSVATAATQMAQTSQEMAISAQRANDFAEKAQTQAHDGTQIVSRATEGMKALSVQV
IEAAKVIKELRSSSEQIGEVLSVIRNIADQTNLLALNAAIEAARAGEQGRGFAVVADEVR
TLASRTQDSTANIQGIIQTLQQSALQAEQVMESGVEQARVGQDLTTQVEQALSDIASAIV
SIQQQTVEITVAIGQQAVVAEEVAQNVVSVRGLSDQSLLSSQDLSQSLQGFEQATHELTR
NIGQFKI