Protein Info for Shewana3_0944 in Shewanella sp. ANA-3

Annotation: ApbE family lipoprotein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 transmembrane" amino acids 38 to 57 (20 residues), see Phobius details PF02424: ApbE" amino acids 72 to 351 (280 residues), 309.5 bits, see alignment E=1.1e-96

Best Hits

Swiss-Prot: 54% identical to APBE_VIBC3: FAD:protein FMN transferase (apbE) from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)

KEGG orthology group: K03734, thiamine biosynthesis lipoprotein (inferred from 100% identity to shn:Shewana3_0944)

MetaCyc: 54% identical to flavin transferase (Vibrio cholerae)
RXN-14461 [EC: 2.7.1.180]

Predicted SEED Role

"Thiamin biosynthesis lipoprotein ApbE"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTR0 at UniProt or InterPro

Protein Sequence (374 amino acids)

>Shewana3_0944 ApbE family lipoprotein (RefSeq) (Shewanella sp. ANA-3)
MWSRALICNFCIKGHPKELLVTMFKTLALKTPVLKTSVLKHSVSWLVLVGLAFFISACSK
QDEVISLAGSTMGTTYHIKVVPNEQMPTAQLLQAEIDLALELVNNQMSTYRPNSELSRFN
QLPLEQSVEVSPDTIKVVKEGMRLYNVTDKALDITLGPLVNLWGFGPDKRPTKVPTQADI
DAAKAKTGISELSIEGNRLSKHNAHLYVDLSSIAKGFGVDKVASILDKYHASGYLVEIGG
ELSIKGTKGDGSSWRVAIEKPTDDGMAVQQVIEPGTMAMATSGDYRNYYEEEGQRFTHII
DPRTGLPINHKLASVTVLHKKCMTADGFATAMMVLGTEASLELAKKEHLAIMLIEKQGEG
FKVYYSDAFKPFLK