Protein Info for Shewana3_0918 in Shewanella sp. ANA-3

Annotation: Na+/H+ antiporter NhaC (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 14 to 37 (24 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 124 to 154 (31 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 207 to 225 (19 residues), see Phobius details amino acids 244 to 273 (30 residues), see Phobius details amino acids 296 to 319 (24 residues), see Phobius details amino acids 389 to 412 (24 residues), see Phobius details amino acids 422 to 441 (20 residues), see Phobius details PF03553: Na_H_antiporter" amino acids 16 to 225 (210 residues), 61.2 bits, see alignment E=5.3e-21 amino acids 236 to 440 (205 residues), 26.1 bits, see alignment E=2.5e-10

Best Hits

KEGG orthology group: None (inferred from 99% identity to she:Shewmr4_0919)

Predicted SEED Role

"Methionine transporter MetT" in subsystem Methionine Biosynthesis or Methionine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTN4 at UniProt or InterPro

Protein Sequence (445 amino acids)

>Shewana3_0918 Na+/H+ antiporter NhaC (RefSeq) (Shewanella sp. ANA-3)
MSQSAQTTAPSSPASFIALLPLFVFLSLFIGAGVYFQSQGVDFAFYQLPSVIAILPAIIL
ALVLSKQKLNQAIDTFIGGIGHSNIIAMCLIYLLAGGFAAVAKATGGVDATVALGLSLIP
SNLLLPGFFVIAAFIATAMGTSMGTIAAVAPIALGVADQAQIDYALMAGAVMSGALFGDN
LSIISDTTIAATRTQGCDMKDKFRENLIFAIPASLLTFVAFVIAGQGQADLAAQDIDFIK
VIPYLTILVLAVAGLNVFVVLTLGILLAGAAGFLTMDYGVIQFGKDIYAGFSNMQEIFIL
SMLVGGLAALMQQQGGLAFVSKQIEKLITRFSKAQGEASCRAAELGMAGIVAVTNSCVAN
NTVSIVVTGDIAKDLAEKHGVSPKRAASVLDIFACIIQGLIPYGAQALLIASTFSITPLA
AVSHAWYCMILAAVAIAIVIFRKRH