Protein Info for Shewana3_0894 in Shewanella sp. ANA-3

Annotation: diguanylate cyclase with PAS/PAC and GAF sensors (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 TIGR00229: PAS domain S-box protein" amino acids 26 to 140 (115 residues), 66.2 bits, see alignment E=3.1e-22 PF00989: PAS" amino acids 27 to 124 (98 residues), 33.9 bits, see alignment E=1.2e-11 PF08448: PAS_4" amino acids 33 to 133 (101 residues), 40.8 bits, see alignment E=1e-13 PF13426: PAS_9" amino acids 35 to 133 (99 residues), 46.2 bits, see alignment E=2.1e-15 PF08447: PAS_3" amino acids 48 to 122 (75 residues), 46.8 bits, see alignment E=1.3e-15 PF13185: GAF_2" amino acids 155 to 292 (138 residues), 38.8 bits, see alignment E=5e-13 PF01590: GAF" amino acids 156 to 291 (136 residues), 45.1 bits, see alignment E=6.7e-15 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 300 to 464 (165 residues), 155.8 bits, see alignment E=8.2e-50 PF00990: GGDEF" amino acids 304 to 461 (158 residues), 171.1 bits, see alignment E=7.3e-54

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0894)

Predicted SEED Role

"GAF domain/GGDEF domain/EAL domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTL3 at UniProt or InterPro

Protein Sequence (482 amino acids)

>Shewana3_0894 diguanylate cyclase with PAS/PAC and GAF sensors (RefSeq) (Shewanella sp. ANA-3)
MPQYDDVNEPQAWLESCVKNDGYTSLSQFVDLLLDAICVVDKTGHFEFVSAGAERIFGYT
PDEMLGMQMLDLVYPPDRERTLAAANDIMEGRFKLDFENRYVRKDGTLVDILWSARWSED
RQQRIAVARDITKNKIAERRQAALYEISEAVHVAEDLLALYRHIHQIMAKLLPAANFAIA
LYDQDLNDLDFPYRVGVGEQNRAQCASFDLFTEQVIQSAESLLICPVAMPVSHAQEQDFQ
NQPISWLGVPLKLQKGIIGALIMHSTPDSRAYTKQDCELVEFVSTQIAFAIERRQMLARL
EHIALYDQLTHLPNRELFYDRFQKALSRANRESSYFSLLYLDLDKFKWVNDTYGHGVGDL
LLQITAQRILGCVRNSDTVARFGGDEFVILLERVDSAQNTLLVAQKILEVLNHPFELVNQ
QIHILPSIGIALYPEHGKDEKQLLSCADSAMYKAKRNGGNRVEMGYQGLKTCYFESLSPH
HL