Protein Info for Shewana3_0870 in Shewanella sp. ANA-3

Annotation: major facilitator transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 205 to 228 (24 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details amino acids 294 to 314 (21 residues), see Phobius details amino acids 327 to 350 (24 residues), see Phobius details amino acids 356 to 375 (20 residues), see Phobius details PF07690: MFS_1" amino acids 15 to 343 (329 residues), 55 bits, see alignment E=3.3e-19 amino acids 208 to 386 (179 residues), 44.9 bits, see alignment E=3.9e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0870)

Predicted SEED Role

"Permease of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTI9 at UniProt or InterPro

Protein Sequence (401 amino acids)

>Shewana3_0870 major facilitator transporter (RefSeq) (Shewanella sp. ANA-3)
MNATQTQNPKALLLWMTFVMSLVFAVWQALLNNFVIEKAQFTGAEIGMLQSLREIPGFLA
FTAIFVLLLVREQAFALLSLALLCIGVAITGFFSQVLGLYLTTILMSVGFHYFETINQSL
TLQWVDKQDTAAFMGKALAWRSAAALVGYGSIWLVMTWLKLDYWHMYLIIGVLGLLMVIS
MSLYYPQFDTHEVQHKKVILRKRYWLYYLLTFFSGARRQIFMVFAGFMMVEKFGYSVSEI
TALFLINYVVNLLFAPAIGRFIGRIGERNALTVEYIGLFFVFVSYALVEQPHMAAALYVI
DHLLFAMAIAMKTYFQKIADSKDIAATMSVSFTINHIAAVVIPVLLGLLWLSDPALVFYI
GAGFAVCSLVLALNVPRHPSPGNETYWAWPAKSIDKPSLDS