Protein Info for Shewana3_0865 in Shewanella sp. ANA-3

Annotation: TrkA domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 574 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 44 (18 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 129 to 153 (25 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 384 to 401 (18 residues), see Phobius details amino acids 407 to 424 (18 residues), see Phobius details amino acids 431 to 452 (22 residues), see Phobius details amino acids 463 to 483 (21 residues), see Phobius details amino acids 490 to 508 (19 residues), see Phobius details amino acids 514 to 532 (19 residues), see Phobius details amino acids 552 to 572 (21 residues), see Phobius details PF03600: CitMHS" amino acids 18 to 506 (489 residues), 151.6 bits, see alignment E=4.5e-48 PF02080: TrkA_C" amino acids 293 to 349 (57 residues), 43.5 bits, see alignment 3.7e-15 PF00939: Na_sulph_symp" amino acids 425 to 567 (143 residues), 32.1 bits, see alignment E=1e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0865)

Predicted SEED Role

"Sulfate permease, Trk-type" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTI4 at UniProt or InterPro

Protein Sequence (574 amino acids)

>Shewana3_0865 TrkA domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MSDLWLLAIVLFGLVAGLIAGRINPAVLFLFAFLLCYLLGMVSLDTALTSFTNTGLVTLV
LLVLAATALEKTSLLGKLSQVIGNNSLAVTMAKLGFSTALLSSFTNNTAVVASLIGVVRR
NQAHAPAKLLLPLNYAAILGGTLTLIGTSTNLIVNSFVENAGLPALGFFEFTPVAMLIVL
LGIVLLIVLANTLPDRREDSTEETLPYLLEAHVAKGSSLVGRSVVDNKLRALKKLYLVEL
ERSGICICPVPPQLVLQADDVLRFSGAVESVELLHQFDGLDWFGKHQAKGQNLVEAVLAP
SSSLVGSTLKESRFREQFDAAVMAIRRGHHPLKGGLGDIVLQPGDVLLLTPGDGFSTNAK
LSTEFAAVSGLDLNVRLDSRRSRFVLSSFVITIVLSLTGVLPLAKGLVLLLLSYFAIGAV
TLSELKRRFPLELVVIVGSALGLANLMMSTGLADGLAQGLLGTINGYGVFGAFVGVYLVT
LLLTELVTNNAAAALAFPIAYAVALNYGVDPRPFIMAVVFGASASFISPYGYQTNLMVFN
AGNYRFSDFLRLGLPLSVLYSLIVIFMVPVIFPF