Protein Info for Shewana3_0848 in Shewanella sp. ANA-3
Annotation: lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 46% identical to LPXL_HAEIN: Lipid A biosynthesis lauroyltransferase (lpxL) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
KEGG orthology group: K02517, lipid A biosynthesis lauroyl acyltransferase [EC: 2.3.1.-] (inferred from 100% identity to shn:Shewana3_0848)MetaCyc: 42% identical to lauroyl acyltransferase (Escherichia coli K-12 substr. MG1655)
LAUROYLACYLTRAN-RXN [EC: 2.3.1.241]
Predicted SEED Role
"Lipid A biosynthesis lauroyl acyltransferase (EC 2.3.1.-)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.-)
MetaCyc Pathways
- superpathway of (Kdo)2-lipid A biosynthesis (15/17 steps found)
- (Kdo)2-lipid A biosynthesis (E. coli) (2/2 steps found)
- superpathway of Kdo2-lipid A biosynthesis (15/25 steps found)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- Alkaloid biosynthesis I
- Alkaloid biosynthesis II
- Anthocyanin biosynthesis
- Benzoate degradation via CoA ligation
- Biosynthesis of terpenoids and steroids
- Biosynthesis of type II polyketide backbone
- Biosynthesis of unsaturated fatty acids
- Butanoate metabolism
- Carotenoid biosynthesis - General
- Diterpenoid biosynthesis
- Ether lipid metabolism
- Ethylbenzene degradation
- Fatty acid biosynthesis
- Glycerophospholipid metabolism
- Glycosphingolipid biosynthesis - ganglio series
- Histidine metabolism
- Limonene and pinene degradation
- Lipopolysaccharide biosynthesis
- Lysine degradation
- Phenylalanine metabolism
- Tyrosine metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.3.1.-
Use Curated BLAST to search for 2.3.1.- or 2.3.1.241
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0KTG7 at UniProt or InterPro
Protein Sequence (283 amino acids)
>Shewana3_0848 lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase (RefSeq) (Shewanella sp. ANA-3) MRITQVLPLSWQMKLGKGLGRLVKTIAGSRTHTARRNLTLCFPDMPESEREALLTRNFEE TGKAIFDTINAWWWTDEKIQQHMQITGKEYVQDTLNAGHGVILFAVHCLPLEMGARIFGQ FQPGVGVYRPHNNPVMEYLQVKGRLRSNKALVPKRDLRQMVRCLRNPDVIWYTADQDFGR SSAVFIPFYAVPDAATITGATTLAKLGKAKVLPFFVERTEGDKGYHIEIMPPLDNFPGED ELADAIRGNKIIEGIIDRNRAQYMWLHRRFKTRPDPTDKSLYK