Protein Info for Shewana3_0829 in Shewanella sp. ANA-3

Annotation: spermidine synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 577 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 88 to 112 (25 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details PF01564: Spermine_synth" amino acids 316 to 509 (194 residues), 115.7 bits, see alignment E=9.9e-38

Best Hits

Swiss-Prot: 94% identical to SPEE_SHEON: Polyamine aminopropyltransferase (speE) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00797, spermidine synthase [EC: 2.5.1.16] (inferred from 100% identity to shn:Shewana3_0829)

Predicted SEED Role

"Spermidine synthase (EC 2.5.1.16)" in subsystem Polyamine Metabolism (EC 2.5.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.16

Use Curated BLAST to search for 2.5.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTE8 at UniProt or InterPro

Protein Sequence (577 amino acids)

>Shewana3_0829 spermidine synthase (RefSeq) (Shewanella sp. ANA-3)
MHESQTTSSATQAVQTSRLSWFDDVLLLGIMAVLAGCGLIYEYLLSHYAGRILGALEAAI
YTMIGLMIVSMGLGAFAARKIKDAFTGFVVLELTVALCGSLAILITAAVIGFGQQLPMLI
ASTLGLPPDQLPEGGMIGSLQKLSEHLPYVWGVLLGLMIGMEIPLIARVRQSLSDEHLLH
NAGTIYGADYIGAGIGAAIWVGFMLAIDIQLAAALTASFNLLAGFVFIWRFWPKIQRAKL
LLAGHFVVTGVLLLLAIQGPSWEQQFNNLLYKDKVVYAKATRFQQLTFTERLRGNGLSPI
YSLYINGRLQFSSIDEHIYHAFLVHPTLAASARHNKVLIIGGGDGLGLKQVLRWEPEQVT
LLDLDAALVQLFKTPDTDMPKRLSQALLALNGNAFNDPRVKVINDDAFNGVDKLIAAGDK
YDAIIVDLPDPSHPDLNKLYSDYFYRKLKELMSNDGALTVQSTSPYHAQKAFISVAKTLA
LAGFDVKQYHHNVPSFGEWGWSIATLSGKDAQHRLGELTTLPIADDWLTLGLVKGAFEFP
ANFYQDAASIKPNELGSLQLYHYHQQAWSETQGLDLF