Protein Info for Shewana3_0827 in Shewanella sp. ANA-3

Annotation: phage shock protein A, PspA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 PF04012: PspA_IM30" amino acids 2 to 228 (227 residues), 145.9 bits, see alignment E=7e-47

Best Hits

KEGG orthology group: None (inferred from 99% identity to son:SO_3765)

Predicted SEED Role

"PspA/IM30 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTE6 at UniProt or InterPro

Protein Sequence (229 amino acids)

>Shewana3_0827 phage shock protein A, PspA (RefSeq) (Shewanella sp. ANA-3)
MGILNKILTAFRGGATEVGQSIVDANSTRIFEQEIRDAEKHLTNAKRELTDVMAKEMQAS
REVDRLKRSIAEHEGYATQALDKGNEALAIEVAEKIAQLEQELAEQQTANDSFSAHAVRL
KDLVKKTERQLSDYQRQLSMVKTTESVQKATATITDSFASSNSKLLNAKDSLERIKARQQ
QFDDRLKAAETLAEEGSDKSLQAKLAEAGIGEQKSNANAVLERIKARKS