Protein Info for Shewana3_0821 in Shewanella sp. ANA-3

Annotation: phosphate transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 17 to 36 (20 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 96 to 119 (24 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 265 to 283 (19 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details amino acids 352 to 372 (21 residues), see Phobius details amino acids 378 to 398 (21 residues), see Phobius details amino acids 403 to 426 (24 residues), see Phobius details PF01384: PHO4" amino acids 34 to 417 (384 residues), 402.9 bits, see alignment E=6.1e-125

Best Hits

KEGG orthology group: K03306, inorganic phosphate transporter, PiT family (inferred from 99% identity to shm:Shewmr7_0852)

Predicted SEED Role

"Probable low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTE0 at UniProt or InterPro

Protein Sequence (429 amino acids)

>Shewana3_0821 phosphate transporter (RefSeq) (Shewanella sp. ANA-3)
MVDAGMEVANVLATNGPWLIAIAAAFGFLMAWGIGANDVANAMGTSVGSNAITIKQAIII
AMIFEFAGAYLAGGEVTSTIRNGIIDSSYFTQTPELLVYGMIGSLLAAGIWLVVASALGW
PVSTTHSIVGAIIGFAAVGVGTDSVAWEKVGGIVGSWVITPAISGFMAFILFQSTQKLIF
NTDNPLANAKRYVPFYMAFAGFIMSLVTILKGLSHVGIHLKGAEAYLLAGVIALIVGIVG
KVVISRLKMDEKATHKTMYANVEKVFAILMVLTACCMAFAHGSNDVANAIGPLAAVVSVV
NSGGQIASKSALVWWILPLGAVGIVMGLAIFGKRVMQTIGKNITHLTPSRGFAAELAAAS
TVVIASGTGLPISTTQTLVGAVLGVGMARGIAAINIGVVRNIVVSWVVTLPAGAGLSIIF
FFMIKGIFN