Protein Info for Shewana3_0812 in Shewanella sp. ANA-3

Annotation: cysteine/glutathione ABC transporter membrane/ATP-binding component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 653 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 263 to 287 (25 residues), see Phobius details amino acids 312 to 330 (19 residues), see Phobius details TIGR02857: thiol reductant ABC exporter, CydD subunit" amino acids 24 to 595 (572 residues), 603.5 bits, see alignment E=2.1e-185 PF00664: ABC_membrane" amino acids 27 to 296 (270 residues), 142.1 bits, see alignment E=2.9e-45 PF00005: ABC_tran" amino acids 406 to 553 (148 residues), 112.3 bits, see alignment E=2.9e-36

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 100% identity to shn:Shewana3_0812)

Predicted SEED Role

"Transport ATP-binding protein CydD" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTD1 at UniProt or InterPro

Protein Sequence (653 amino acids)

>Shewana3_0812 cysteine/glutathione ABC transporter membrane/ATP-binding component (RefSeq) (Shewanella sp. ANA-3)
MDKSLEKSLLVWLKSQKKACGWFVKLSVWCGMLSAIALIAQAYLIATLLDGVIVDNALQA
FTEGGNSTPIQPAVGASDYLPHFMALIGLMLLRALLAYGRERASFEAGKRLRQQIRGAVM
DKLTRLGPAFIKGKPAGSWASIVLEQVEDLQDFYARYLPQMTLAGVIPLLILIAVFPINW
AAGLILLLTAPLIPLFMILVGMGAADANRKNFNALARLSGHFMDRLKGLATLKLFHRGDA
ELKVIEKASEEFRSRTMSVLRMAFLSSAVLEFFAAVSIAVLAVYFGFSYLGHLDFGYYGA
HAQLGPNANEGLPFSLFVGLFILILAPEFYQPLRDMGTHYHAKAQAIGAAQALMTLLEHP
EPESSSEPKSGSAQDKLGLQTRLDKLTHLSVKDLEVYSTDGSRLLGPISFELKQGEHLAL
VGPSGAGKTSLLNALLGFLPYKGKLLIDGVELASLDLAHWRQQLAWLGQEPQLFHGTVRE
NVALANPEMTDEQVWQLLEQANIHEFVRAQPLGLATPIGEQSSTLSVGQAQRIALARALG
QAAQVFILDEPTASLDSVSEQLVSRTLKAAMAGKMGIMVTHRVDQLDHMSSILVLDKGKI
VQRGDFATLSTEVGLFQTMLHENTESVADIGLEPSMPDTHSDIALGTIEGAAQ