Protein Info for Shewana3_0807 in Shewanella sp. ANA-3

Annotation: Fe-S metabolism associated SufE (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 PF02657: SufE" amino acids 24 to 141 (118 residues), 136 bits, see alignment E=2.9e-44

Best Hits

Swiss-Prot: 43% identical to CSDE_ECOLI: Sulfur acceptor protein CsdE (csdE) from Escherichia coli (strain K12)

KEGG orthology group: K02426, cysteine desulfuration protein SufE (inferred from 100% identity to shn:Shewana3_0807)

MetaCyc: 43% identical to sulfur acceptor protein CsdE (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Cysteine desulfurase CsdA-CsdE, sulfur acceptor protein CsdE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTC6 at UniProt or InterPro

Protein Sequence (147 amino acids)

>Shewana3_0807 Fe-S metabolism associated SufE (RefSeq) (Shewanella sp. ANA-3)
MTLPIMPAATEFDYSVEDSSSLLARFEQAPNWQERYRQIMLLGKTLPSLADEFRLEAAQV
KGCESDAWLYHIERDAKHYFLADSDARIVKGLIGLLLSACHGKQSDEILAFDPSTYFKQL
GLEGQLSPSRTNGLHALAKAMIDAVKP