Protein Info for Shewana3_0789 in Shewanella sp. ANA-3

Annotation: sterol desaturase family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 53 to 77 (25 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 139 to 156 (18 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 92 to 226 (135 residues), 115.4 bits, see alignment E=1.3e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0789)

Predicted SEED Role

"Sterol desaturase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KTA8 at UniProt or InterPro

Protein Sequence (287 amino acids)

>Shewana3_0789 sterol desaturase family protein (RefSeq) (Shewanella sp. ANA-3)
MDIAALINHPEVLLLVLAPLFFVCILLEWYFGDRRQKLPVSARYHTKEVLCNFSLAAMHQ
GVDILAGLLIAKLYLAVFGWKLFDIQMGPLSFVLLMIAQDFCYYWFHRASHRVRWMWAAH
VVHHSSENMNFSTAFRQSLMYPFAGMWVFWLPLVILGFDPNWVVFVVLLNLGLQFFVHTQ
AVKKLGPLEWLFNTPSHHRVHHGRNPQYIDKNYAGILIIWDKLFGTFVPEEETVIYGITK
PVNSFNPLKVTFSEWRDMFSEVTTRGLTFSERCKILFAPPASQQKDE