Protein Info for Shewana3_0778 in Shewanella sp. ANA-3

Annotation: ammonium transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 transmembrane" amino acids 36 to 55 (20 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details amino acids 337 to 357 (21 residues), see Phobius details amino acids 369 to 395 (27 residues), see Phobius details amino acids 413 to 436 (24 residues), see Phobius details TIGR00836: ammonium transporter" amino acids 64 to 464 (401 residues), 447.9 bits, see alignment E=1.7e-138 PF00909: Ammonium_transp" amino acids 66 to 464 (399 residues), 394.5 bits, see alignment E=2.4e-122

Best Hits

Swiss-Prot: 46% identical to Y663_METTH: Putative ammonium transporter MTH_663 (MTH_663) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)

KEGG orthology group: K03320, ammonium transporter, Amt family (inferred from 100% identity to shn:Shewana3_0778)

MetaCyc: 47% identical to ammonium transporter (Escherichia coli K-12 substr. MG1655)
RXN-9615

Predicted SEED Role

"Ammonium transporter" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KT97 at UniProt or InterPro

Protein Sequence (466 amino acids)

>Shewana3_0778 ammonium transporter (RefSeq) (Shewanella sp. ANA-3)
MSQQTAALNAKLERSTNIPNGQHAKFAQPNARYSKLGYQALLALLTSGFAGSVLADEAQL
SGANTAWILSSSALVLLMTLPGLALFYGGLVRSKNVLSILMQCFSIAAIASVLWFVVGYS
IAFDTGNGFIGGLGKAFLASIGRDSVSGDIPEPLFMLFQMTFAIITPALIIGGFAERMRF
SAVLMFSSAWLLLVYAPITHWVWGGGWLAELGLYDFAGGTVVHITAGVAALVAAKVLGPR
KGFLNSAIMPHNLTMTVTGAGMLWVGWFGFNGGSALGANGTAAMAILATHLAASMGAITW
AGIEWYKFGKASALGIVTGMVAGLGTITPASGYVGPAGALVIGFLGGVVCFFSTVYIKQK
LKIDDSLDVFPVHGVGGILGTLLAGVFSSTQLGIFSGYGFASVNPTMLDQLGAQAIGVIA
TLSYTALVSWLLFVVIGKILGGLRVSTEQEVNGLDLSEHEETGYSL