Protein Info for Shewana3_0775 in Shewanella sp. ANA-3

Annotation: 2-dehydro-3-deoxyphosphooctonate aldolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 PF00793: DAHP_synth_1" amino acids 10 to 273 (264 residues), 251.1 bits, see alignment E=4.7e-79 TIGR01362: 3-deoxy-8-phosphooctulonate synthase" amino acids 18 to 273 (256 residues), 396.4 bits, see alignment E=2.2e-123

Best Hits

Swiss-Prot: 100% identical to KDSA_SHESR: 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA) from Shewanella sp. (strain MR-7)

KEGG orthology group: K01627, 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase) [EC: 2.5.1.55] (inferred from 99% identity to son:SO_3827)

MetaCyc: 70% identical to 3-deoxy-D-manno-octulosonate 8-phosphate synthase (Escherichia coli K-12 substr. MG1655)
3-deoxy-8-phosphooctulonate synthase. [EC: 2.5.1.55]

Predicted SEED Role

"2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase (EC 2.5.1.55)" in subsystem KDO2-Lipid A biosynthesis (EC 2.5.1.55)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.55

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KT94 at UniProt or InterPro

Protein Sequence (282 amino acids)

>Shewana3_0775 2-dehydro-3-deoxyphosphooctonate aldolase (RefSeq) (Shewanella sp. ANA-3)
MSNKIINLGSIEIANDKPFVLFGGMNVLESRDLAMSIAETYAEVTQKLGIPYVFKASFDK
ANRSSVNSYRGPGMEEGLKIFEEIKKTFNLPLITDVHETYQCAPVAEVVDIIQLPAFLAR
QTDLVVAMAKTGAIINVKKPQFLAPHEMRHIITKFNEAGNDEIILCERGSCFGYNNLVVD
MLGMDEMKQSGYPVIFDATHALQRPGGRADSAGGRRAQATELARSGMALGLAGLFIEAHP
DPDNAKCDGPCALPLHQLENYLKQMKAIDDLVKSFDPIDTSK