Protein Info for Shewana3_0747 in Shewanella sp. ANA-3

Annotation: diguanylate cyclase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 646 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details transmembrane" amino acids 444 to 464 (21 residues), see Phobius details PF13181: TPR_8" amino acids 289 to 310 (22 residues), 13.9 bits, see alignment (E = 1.3e-05) TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 473 to 642 (170 residues), 141.4 bits, see alignment E=1.1e-45 PF00990: GGDEF" amino acids 477 to 637 (161 residues), 136.2 bits, see alignment E=2.2e-43

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0747)

Predicted SEED Role

"GGDEF domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KT66 at UniProt or InterPro

Protein Sequence (646 amino acids)

>Shewana3_0747 diguanylate cyclase (RefSeq) (Shewanella sp. ANA-3)
MISYLFQCEQETFPLPHTQRNLSLFLMLLLVPLSLAVAEEKPQIDQIFKLFESGEVMARE
SVEQNIALLDKLIASDDVEHIEKLKMLKCWNQPAETEAEILLARDKAQEALNSIPTTASV
HFATDLTLCHSWFLQLSGDINGAMEGYSRSIKTAYEHEDIKLIADARSLRGALYSYIGDF
SAALDDLVTAQGLYESLNLTGWANINLTDIATSFRRYGDPESAIKYYNKLKELYLKKGNE
EQVANVTSDIGIALDEMGEHEQAIENFRFSYQYFKKHRLNNAAAVNATNIAYSLIQLNRL
DEAEKYLKEAELEITANEPAAYSFMKLFMGKIRYQQGRYQEALSELADAENAFRAMQNDR
GLVQLLQLKSEVYAAMNDLPSAYQTLQQFVALTRKVEDNSFAHQTTELKVKFDTSWIESE
NKRLLDNQKLKEQELALLEKNKSLQLIILLLTGCILAIVSLFAYKQVHRNRHLQTIALTD
YLTQLPNRRYIYAKAEQYFQQALKQQTPLSVIIFDADHFKKINDNFGHEIGDQALLTIAQ
ASQALTADRNLIGRIGGEEFLILLPNTNAERVWELAHELQTLITRYGAINLPVELKLTVS
AGVATLNTELGKQDDSFARLLKRADNALYDAKNAGKNCVKVAKATS