Protein Info for Shewana3_0741 in Shewanella sp. ANA-3

Name: modC
Annotation: molybdate transporter ATP-binding protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 TIGR02142: molybdate ABC transporter, ATP-binding protein" amino acids 2 to 352 (351 residues), 448.7 bits, see alignment E=8.3e-139 PF00005: ABC_tran" amino acids 17 to 156 (140 residues), 103.4 bits, see alignment E=1.6e-33 PF03459: TOBE" amino acids 290 to 349 (60 residues), 52.3 bits, see alignment E=5.6e-18

Best Hits

Swiss-Prot: 98% identical to MODC_SHESR: Molybdenum import ATP-binding protein ModC (modC) from Shewanella sp. (strain MR-7)

KEGG orthology group: K02017, molybdate transport system ATP-binding protein [EC: 3.6.3.29] (inferred from 100% identity to shn:Shewana3_0741)

MetaCyc: 54% identical to molybdate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]

Predicted SEED Role

"Molybdenum transport ATP-binding protein ModC (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.29 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KT60 at UniProt or InterPro

Protein Sequence (361 amino acids)

>Shewana3_0741 molybdate transporter ATP-binding protein (RefSeq) (Shewanella sp. ANA-3)
MLNINIEKQLGQLQLKVNTQLPLQGVTAVFGRSGAGKTSLVNLLGGLTTPDKGEISLGDT
LLFKHKTVNLPPEKRRIGYVFQEARLFPHYSVKGNLTYGMRHKAPELFDKVVSLLGIEKL
LSRYPSTLSGGEKQRVAIGRALLTSPQMLLMDEPLASLDLPRKRELLPYLQTLAQELKLP
IVYVSHSLDEILQLADHMLVLHQGKMIAQGPLTQVWNSEQMRPWVPLQELSSLLSARIAD
RHPDYPMTRLLMDDGNQLWVSGQLPPTHKQLKVRIQANHVSVCTEEPKGSSIRNLLKGKI
KELYPSDNGEQIQLKIALGKDELWANITPWACDELQLTPGKNIYAQIKGVTMTQMDIAES
H