Protein Info for Shewana3_0731 in Shewanella sp. ANA-3

Annotation: L-sorbosone dehydrogenase, putative (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF23500: DUF7133" amino acids 42 to 364 (323 residues), 58.4 bits, see alignment E=1.3e-19 PF22807: TrAA12" amino acids 43 to 228 (186 residues), 34.9 bits, see alignment E=1e-12 amino acids 270 to 372 (103 residues), 38 bits, see alignment E=1.3e-13 PF07995: GSDH" amino acids 129 to 372 (244 residues), 55.7 bits, see alignment E=7.6e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_0731)

Predicted SEED Role

"L-sorbosone dehydrogenase, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KT50 at UniProt or InterPro

Protein Sequence (391 amino acids)

>Shewana3_0731 L-sorbosone dehydrogenase, putative (RefSeq) (Shewanella sp. ANA-3)
MLYIKTNNYKYLRVFSAFGALLASLALLTSQAAIAGSQSIMITVSKGFGLSLYASDLGDA
KQIAMGSNGTLFVGSNKSGIVHALVDSNQDGRVDKRYVIAKGLESPDAIAFHNGDLFVAT
ENRIVRFIDIEQRLRRPTRPKEIYSDLPESDKKSARAMNFGPDGRLYVSIGAPCNVCEAS
APYSSIIAINVDTGASEQIALGVRDATGFDWSPQDGKLWFADQGRDWMGDNLPPDEINRV
DVIGSHYGFPYLHASSVVEPAYEKPKNLKITVPVYELPAHVAPTGLAFYRGKQFPEIYHN
QLFVAENGSWNRSSKVGYQIVMLKLENEQVVSRETVVSFLDGEFPVARPYALLSGEDGAM
YISDDLKGNLYRLFYKDGDNTEEPQELEENE