Protein Info for Shewana3_0710 in Shewanella sp. ANA-3

Annotation: iron hydrogenase, small subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details PF02256: Fe_hyd_SSU" amino acids 46 to 101 (56 residues), 78.8 bits, see alignment E=1.2e-26

Best Hits

KEGG orthology group: None (inferred from 98% identity to she:Shewmr4_3251)

Predicted SEED Role

"Periplasmic [Fe] hydrogenase small subunit (EC 1.12.7.2)" in subsystem Hydrogenases (EC 1.12.7.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.12.7.2

Use Curated BLAST to search for 1.12.7.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KT29 at UniProt or InterPro

Protein Sequence (106 amino acids)

>Shewana3_0710 iron hydrogenase, small subunit (RefSeq) (Shewanella sp. ANA-3)
MNKKKHLFAEDSFFLSRRKFMAVGAAFVAALAIPIGWFSSKLERRNEYIKARSQGLYKDD
SLAKKRVSHANPAVEKYYKEFGGEPLGHMSHELLHTHFVDRTKLSS